User talk:Jaroslav Krupka/Archive 1
This is an archive of past discussions. Do not edit the contents of this page. If you wish to start a new discussion or revive an old one, please do so on the current talk page. |
File tagging File:Skeleton 4926, the crucified man.jpg
This media was probably deleted.
|
Thanks for uploading File:Skeleton 4926, the crucified man.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Skeleton 4926, the crucified man.jpg]] ) and the above demanded information in your request. |
And also:
- File:A nail in the heel bone.jpg
- File:Car of Kyle Clinkscales.jpg
- File:Kyle Clinkscales, missing american student, Auburn.jpg
- File:Mysteriously Shaped Structure in Wilderness.jpg
- File:Illustration of Earth's Black Box in Tasmania.jpg
- File:Mt. Hibok-Hibok eruption, December 4, 1951.jpg
- File:Frida Michelson.jpg
- File:118917070 powsataprayerservicethatmichaelhurstthinkswasputonasapublicitystuntatthetaiwancopperminecamp-kinkasekiprayerservice1944-2cropped-2.jpg
- File:Kristen H. Gilbert.jpg
- File:Tragical day on Monza 1961.jpg
- File:Into the air. Von Trips car on Monza 1961.jpg
- File:Von Trips car is heading straight for the people.jpg
- File:The accident was fatal for Von Trip and 13 spectators.jpg
- File:Monza 1961, Wolfgang von Trips Fatal crash.jpg
- File:Orlando Sabino Camargo.jpg
- File:Rita Hayworth, pin-up girl.jpg
Yours sincerely, Ytoyoda (talk) 16:14, 13 December 2021 (UTC)
File tagging File:Archaeopteryx-feather.jpg
This media was probably deleted.
|
Thanks for uploading File:Archaeopteryx-feather.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Archaeopteryx-feather.jpg]] ) and the above demanded information in your request. |
User who nominated the file for deletion (Nominator) : Marbletan.
And also:
- File:Dickinsonia-fossils.jpg ( Nominator : Marbletan | Reason : This media file is missing evidence of permission. )
- File:Hallucigenia-fossil.jpg ( Nominator : Marbletan | Reason : This media file is missing evidence of permission. )
I'm a computer program; please don't ask me questions but ask the user who nominated your file(s) for deletion or at our Help Desk. //Deletion Notification Bot (talk) 13:36, 17 January 2022 (UTC)
File source is not properly indicated: File:William-howell.jpg
This media was probably deleted. |
A file that you have uploaded to Wikimedia Commons, File:William-howell.jpg, was missing information about where it comes from or who created it, which is needed to verify its copyright status. The file probably has been deleted. If you've got all required information, request undeletion providing this information and the link to the concerned file (
[[:File:William-howell.jpg]] ).
If you created the content yourself, enter If someone else created the content, or if it is based on someone else's work, the source should be the address to the web page where you found it, the name and ISBN of the book you scanned it from, or similar. You should also name the author, provide verifiable information to show that the content is in the public domain or has been published under a free license by its author, and add an appropriate template identifying the public domain or licensing status, if you have not already done so. Warning: Wikimedia Commons takes copyright violations very seriously and persistent violators will be blocked from editing. Please add the required information for this and other files you have uploaded before adding more files. If you need assistance, please ask at the help desk. Thank you! |
Túrelio (talk) 08:51, 10 February 2022 (UTC)
File source is not properly indicated: File:William-Devin-Howell.jpg
This media was probably deleted. |
A file that you have uploaded to Wikimedia Commons, File:William-Devin-Howell.jpg, was missing information about where it comes from or who created it, which is needed to verify its copyright status. The file probably has been deleted. If you've got all required information, request undeletion providing this information and the link to the concerned file (
[[:File:William-Devin-Howell.jpg]] ).
If you created the content yourself, enter If someone else created the content, or if it is based on someone else's work, the source should be the address to the web page where you found it, the name and ISBN of the book you scanned it from, or similar. You should also name the author, provide verifiable information to show that the content is in the public domain or has been published under a free license by its author, and add an appropriate template identifying the public domain or licensing status, if you have not already done so. Warning: Wikimedia Commons takes copyright violations very seriously and persistent violators will be blocked from editing. Please add the required information for this and other files you have uploaded before adding more files. If you need assistance, please ask at the help desk. Thank you! |
Túrelio (talk) 08:51, 10 February 2022 (UTC)
This media was probably deleted.
|
Thanks for uploading File:DiagramOFSpineWithDeviceRunningThroughIt 1027.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:DiagramOFSpineWithDeviceRunningThroughIt 1027.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:51, 10 February 2022 (UTC)
This media was probably deleted.
|
Thanks for uploading File:DiagramOFSpineWithDeviceRunningThroughIt 1025.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:DiagramOFSpineWithDeviceRunningThroughIt 1025.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:52, 10 February 2022 (UTC)
File tagging File:DiagramOFSpineWithDeviceRunningThrough.jpg
This media was probably deleted.
|
Thanks for uploading File:DiagramOFSpineWithDeviceRunningThrough.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:DiagramOFSpineWithDeviceRunningThrough.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:52, 10 February 2022 (UTC)
This media was probably deleted.
|
Thanks for uploading File:DiagramOFSpineWithDeviceRunningThroughIt 1026.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:DiagramOFSpineWithDeviceRunningThroughIt 1026.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:52, 10 February 2022 (UTC)
File tagging File:Baby-asteroids.jpg
This media was probably deleted.
|
Thanks for uploading File:Baby-asteroids.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Baby-asteroids.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:52, 10 February 2022 (UTC)
File tagging File:Aerial view of the oldest buddhist temple.jpg
This media was probably deleted.
|
Thanks for uploading File:Aerial view of the oldest buddhist temple.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Aerial view of the oldest buddhist temple.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:52, 10 February 2022 (UTC)
File tagging File:Fossilbb.jpg
This media was probably deleted.
|
Thanks for uploading File:Fossilbb.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Fossilbb.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:53, 10 February 2022 (UTC)
File tagging File:Fossil02.jpg
This media was probably deleted.
|
Thanks for uploading File:Fossil02.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Fossil02.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:53, 10 February 2022 (UTC)
File tagging File:Fossil03bb.jpg
This media was probably deleted.
|
Thanks for uploading File:Fossil03bb.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Fossil03bb.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:53, 10 February 2022 (UTC)
File tagging File:Metesky's arrest.jpg
This media was probably deleted.
|
Thanks for uploading File:Metesky's arrest.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Metesky's arrest.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:54, 10 February 2022 (UTC)
File tagging File:Brooklyn's Paramount Theater.jpg
This media was probably deleted.
|
Thanks for uploading File:Brooklyn's Paramount Theater.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Brooklyn's Paramount Theater.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:54, 10 February 2022 (UTC)
File source is not properly indicated: File:Metesky's letter.jpg
This media was probably deleted. |
A file that you have uploaded to Wikimedia Commons, File:Metesky's letter.jpg, was missing information about where it comes from or who created it, which is needed to verify its copyright status. The file probably has been deleted. If you've got all required information, request undeletion providing this information and the link to the concerned file (
[[:File:Metesky's letter.jpg]] ).
If you created the content yourself, enter If someone else created the content, or if it is based on someone else's work, the source should be the address to the web page where you found it, the name and ISBN of the book you scanned it from, or similar. You should also name the author, provide verifiable information to show that the content is in the public domain or has been published under a free license by its author, and add an appropriate template identifying the public domain or licensing status, if you have not already done so. Warning: Wikimedia Commons takes copyright violations very seriously and persistent violators will be blocked from editing. Please add the required information for this and other files you have uploaded before adding more files. If you need assistance, please ask at the help desk. Thank you! |
Túrelio (talk) 08:54, 10 February 2022 (UTC)
File tagging File:George Metesky.jpg
This media was probably deleted.
|
Thanks for uploading File:George Metesky.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:George Metesky.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:54, 10 February 2022 (UTC)
File source is not properly indicated: File:Metesky's letter02.jpg
This media was probably deleted. |
A file that you have uploaded to Wikimedia Commons, File:Metesky's letter02.jpg, was missing information about where it comes from or who created it, which is needed to verify its copyright status. The file probably has been deleted. If you've got all required information, request undeletion providing this information and the link to the concerned file (
[[:File:Metesky's letter02.jpg]] ).
If you created the content yourself, enter If someone else created the content, or if it is based on someone else's work, the source should be the address to the web page where you found it, the name and ISBN of the book you scanned it from, or similar. You should also name the author, provide verifiable information to show that the content is in the public domain or has been published under a free license by its author, and add an appropriate template identifying the public domain or licensing status, if you have not already done so. Warning: Wikimedia Commons takes copyright violations very seriously and persistent violators will be blocked from editing. Please add the required information for this and other files you have uploaded before adding more files. If you need assistance, please ask at the help desk. Thank you! |
Túrelio (talk) 08:54, 10 February 2022 (UTC)
File tagging File:Alois Grebeníček.jpg
This media was probably deleted.
|
Thanks for uploading File:Alois Grebeníček.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Alois Grebeníček.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:55, 10 February 2022 (UTC)
This media was probably deleted.
|
Thanks for uploading File:Kostel sv. Karla Boromejského, dnes kostel sv. Cyrila a Metoděje.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Kostel sv. Karla Boromejského, dnes kostel sv. Cyrila a Metoděje.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:55, 10 February 2022 (UTC)
File tagging File:Boj o kostel.jpg
This media was probably deleted.
|
Thanks for uploading File:Boj o kostel.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Boj o kostel.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:56, 10 February 2022 (UTC)
File tagging File:Adolf Opálka v civilu.jpg
This media was probably deleted.
|
Thanks for uploading File:Adolf Opálka v civilu.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Adolf Opálka v civilu.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:56, 10 February 2022 (UTC)
File tagging File:Velitel Out Distance Adolf Opálka.jpg
This media was probably deleted.
|
Thanks for uploading File:Velitel Out Distance Adolf Opálka.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Velitel Out Distance Adolf Opálka.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:58, 10 February 2022 (UTC)
File source is not properly indicated: File:Handley-Page Halifax.jpg
This media was probably deleted. |
A file that you have uploaded to Wikimedia Commons, File:Handley-Page Halifax.jpg, was missing information about where it comes from or who created it, which is needed to verify its copyright status. The file probably has been deleted. If you've got all required information, request undeletion providing this information and the link to the concerned file (
[[:File:Handley-Page Halifax.jpg]] ).
If you created the content yourself, enter If someone else created the content, or if it is based on someone else's work, the source should be the address to the web page where you found it, the name and ISBN of the book you scanned it from, or similar. You should also name the author, provide verifiable information to show that the content is in the public domain or has been published under a free license by its author, and add an appropriate template identifying the public domain or licensing status, if you have not already done so. Warning: Wikimedia Commons takes copyright violations very seriously and persistent violators will be blocked from editing. Please add the required information for this and other files you have uploaded before adding more files. If you need assistance, please ask at the help desk. Thank you! |
Túrelio (talk) 08:59, 10 February 2022 (UTC)
File source is not properly indicated: File:Ronald C Hockey.jpg
This media was probably deleted. |
A file that you have uploaded to Wikimedia Commons, File:Ronald C Hockey.jpg, was missing information about where it comes from or who created it, which is needed to verify its copyright status. The file probably has been deleted. If you've got all required information, request undeletion providing this information and the link to the concerned file (
[[:File:Ronald C Hockey.jpg]] ).
If you created the content yourself, enter If someone else created the content, or if it is based on someone else's work, the source should be the address to the web page where you found it, the name and ISBN of the book you scanned it from, or similar. You should also name the author, provide verifiable information to show that the content is in the public domain or has been published under a free license by its author, and add an appropriate template identifying the public domain or licensing status, if you have not already done so. Warning: Wikimedia Commons takes copyright violations very seriously and persistent violators will be blocked from editing. Please add the required information for this and other files you have uploaded before adding more files. If you need assistance, please ask at the help desk. Thank you! |
Túrelio (talk) 08:59, 10 February 2022 (UTC)
File tagging File:Paratroop unit Silver B.jpg
This media was probably deleted.
|
Thanks for uploading File:Paratroop unit Silver B.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Paratroop unit Silver B.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 08:59, 10 February 2022 (UTC)
File source is not properly indicated: File:Parachutist Vladimír Škacha.jpg
This media was probably deleted. |
A file that you have uploaded to Wikimedia Commons, File:Parachutist Vladimír Škacha.jpg, was missing information about where it comes from or who created it, which is needed to verify its copyright status. The file probably has been deleted. If you've got all required information, request undeletion providing this information and the link to the concerned file (
[[:File:Parachutist Vladimír Škacha.jpg]] ).
If you created the content yourself, enter If someone else created the content, or if it is based on someone else's work, the source should be the address to the web page where you found it, the name and ISBN of the book you scanned it from, or similar. You should also name the author, provide verifiable information to show that the content is in the public domain or has been published under a free license by its author, and add an appropriate template identifying the public domain or licensing status, if you have not already done so. Warning: Wikimedia Commons takes copyright violations very seriously and persistent violators will be blocked from editing. Please add the required information for this and other files you have uploaded before adding more files. If you need assistance, please ask at the help desk. Thank you! |
Túrelio (talk) 08:59, 10 February 2022 (UTC)
File source is not properly indicated: File:Jan Zemek, Silver B.jpg
This media was probably deleted. |
A file that you have uploaded to Wikimedia Commons, File:Jan Zemek, Silver B.jpg, was missing information about where it comes from or who created it, which is needed to verify its copyright status. The file probably has been deleted. If you've got all required information, request undeletion providing this information and the link to the concerned file (
[[:File:Jan Zemek, Silver B.jpg]] ).
If you created the content yourself, enter If someone else created the content, or if it is based on someone else's work, the source should be the address to the web page where you found it, the name and ISBN of the book you scanned it from, or similar. You should also name the author, provide verifiable information to show that the content is in the public domain or has been published under a free license by its author, and add an appropriate template identifying the public domain or licensing status, if you have not already done so. Warning: Wikimedia Commons takes copyright violations very seriously and persistent violators will be blocked from editing. Please add the required information for this and other files you have uploaded before adding more files. If you need assistance, please ask at the help desk. Thank you! |
Túrelio (talk) 08:59, 10 February 2022 (UTC)
File source is not properly indicated: File:Vladimír Škacha.jpg
This media was probably deleted. |
A file that you have uploaded to Wikimedia Commons, File:Vladimír Škacha.jpg, was missing information about where it comes from or who created it, which is needed to verify its copyright status. The file probably has been deleted. If you've got all required information, request undeletion providing this information and the link to the concerned file (
[[:File:Vladimír Škacha.jpg]] ).
If you created the content yourself, enter If someone else created the content, or if it is based on someone else's work, the source should be the address to the web page where you found it, the name and ISBN of the book you scanned it from, or similar. You should also name the author, provide verifiable information to show that the content is in the public domain or has been published under a free license by its author, and add an appropriate template identifying the public domain or licensing status, if you have not already done so. Warning: Wikimedia Commons takes copyright violations very seriously and persistent violators will be blocked from editing. Please add the required information for this and other files you have uploaded before adding more files. If you need assistance, please ask at the help desk. Thank you! |
Túrelio (talk) 08:59, 10 February 2022 (UTC)
File tagging File:Protiletecký kryt na Karlově náměstí.jpg
This media was probably deleted.
|
Thanks for uploading File:Protiletecký kryt na Karlově náměstí.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Protiletecký kryt na Karlově náměstí.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:00, 10 February 2022 (UTC)
Source of derivative work is not properly indicated: File:Historical summary.png
This file may be deleted. |
A file that you have uploaded to Wikimedia Commons, File:Historical summary.png, is a derivative work, containing an "image within an image". Examples of such works would include a photograph of a sculpture, a scan of a magazine cover, or a map that has been altered from the original. In each of these cases, the rights of the creator of the original must be considered, as well as those of the creator of the derivative work.
While the description page states who made this derivative work, it currently doesn't specify who created the original work, so the overall copyright status is unclear. If you did not create the original work depicted in this image, you will need to specify the owner of the copyright. Please edit the file description and add the missing information, or the file may be deleted. If you created the original content yourself, enter this information as the source. If someone else created the content, the source should be the address to the web page where you found it, the name and ISBN of the book you scanned it from, or similar. You should also name the author, provide verifiable information to show that the content is in the public domain or has been published under a free license by its author, and add an appropriate template identifying the public domain or licensing status, if you have not already done so. Please add the required information for this and other files you have uploaded before adding more files. If you need assistance, please ask at the help desk. Thank you! |
Túrelio (talk) 09:01, 10 February 2022 (UTC)
This media was probably deleted.
|
Thanks for uploading File:The victims of a circus fire, Niterói, Brazil.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:The victims of a circus fire, Niterói, Brazil.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:03, 10 February 2022 (UTC)
This media was probably deleted.
|
Thanks for uploading File:Survivors of the Gran Circus Norte-Americano fire.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Survivors of the Gran Circus Norte-Americano fire.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:03, 10 February 2022 (UTC)
File tagging File:The fire of the Gran Circus Norte-Americano.jpg
This media was probably deleted.
|
Thanks for uploading File:The fire of the Gran Circus Norte-Americano.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:The fire of the Gran Circus Norte-Americano.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:03, 10 February 2022 (UTC)
File tagging File:The victims of a circus fire, Niterói.jpg
This media was probably deleted.
|
Thanks for uploading File:The victims of a circus fire, Niterói.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:The victims of a circus fire, Niterói.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:04, 10 February 2022 (UTC)
This media was probably deleted.
|
Thanks for uploading File:The victims of the Gran Circus Norte-Americano fire.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:The victims of the Gran Circus Norte-Americano fire.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:04, 10 February 2022 (UTC)
File tagging File:The Niterói circus fire.jpg
This media was probably deleted.
|
Thanks for uploading File:The Niterói circus fire.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:The Niterói circus fire.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:04, 10 February 2022 (UTC)
This media was probably deleted.
|
Thanks for uploading File:The Gran Circus Norte-Americano, Niterói, after the fire.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:The Gran Circus Norte-Americano, Niterói, after the fire.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:04, 10 February 2022 (UTC)
This media was probably deleted.
|
Thanks for uploading File:The Gran Circus Norte-Americano after the fire.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:The Gran Circus Norte-Americano after the fire.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:04, 10 February 2022 (UTC)
File tagging File:Debris of the Gran Circus Norte-Americano.jpg
This media was probably deleted.
|
Thanks for uploading File:Debris of the Gran Circus Norte-Americano.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Debris of the Gran Circus Norte-Americano.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:04, 10 February 2022 (UTC)
File tagging File:The Gran Circus Norte-Americano, debris.jpg
This media was probably deleted.
|
Thanks for uploading File:The Gran Circus Norte-Americano, debris.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:The Gran Circus Norte-Americano, debris.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:04, 10 February 2022 (UTC)
This media was probably deleted.
|
Thanks for uploading File:One of the famous performances in the Gran Circus Norte-Americano.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:One of the famous performances in the Gran Circus Norte-Americano.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:05, 10 February 2022 (UTC)
This media was probably deleted.
|
Thanks for uploading File:Spectators in front of the Gran Circus Norte-Americano.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Spectators in front of the Gran Circus Norte-Americano.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:05, 10 February 2022 (UTC)
This media was probably deleted.
|
Thanks for uploading File:Gran Circus Norte-Americano before the big fire in Niterói, Brazil.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Gran Circus Norte-Americano before the big fire in Niterói, Brazil.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:05, 10 February 2022 (UTC)
File tagging File:Sgr a g objects 1024.jpg
This media was probably deleted.
|
Thanks for uploading File:Sgr a g objects 1024.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Sgr a g objects 1024.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:05, 10 February 2022 (UTC)
File tagging File:Hartford-CT-Building-Photo.jpg
This media was probably deleted.
|
Thanks for uploading File:Hartford-CT-Building-Photo.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Hartford-CT-Building-Photo.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:06, 10 February 2022 (UTC)
File tagging File:CT-Building-Hartford.jpg
This media was probably deleted.
|
Thanks for uploading File:CT-Building-Hartford.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:CT-Building-Hartford.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:06, 10 February 2022 (UTC)
File tagging File:CT-Primary-Hartford.jpg
This media was probably deleted.
|
Thanks for uploading File:CT-Primary-Hartford.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:CT-Primary-Hartford.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:06, 10 February 2022 (UTC)
File tagging File:New-Britain-Ave-Hartford-CT-Primary-Photo.jpg
This media was probably deleted.
|
Thanks for uploading File:New-Britain-Ave-Hartford-CT-Primary-Photo.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:New-Britain-Ave-Hartford-CT-Primary-Photo.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:06, 10 February 2022 (UTC)
File tagging File:Herečka Lída Plachá.jpg
This media was probably deleted.
|
Thanks for uploading File:Herečka Lída Plachá.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Herečka Lída Plachá.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:08, 10 February 2022 (UTC)
File tagging File:Lída Plachá v roli komorné.jpg
This media was probably deleted.
|
Thanks for uploading File:Lída Plachá v roli komorné.jpg. This media is missing permission information. A source is given, but there is no proof that the author or copyright holder agreed to license the file under the given license. Please provide a link to an appropriate webpage with license information, or ask the author or copyright holder to send an email with copy of a written permission to VRT (permissions-commons@wikimedia.org). You may still be required to go through this procedure even if you are the author yourself; please see Commons:But it's my own work! for more details. After you emailed permission, you may replace the {{No permission since}} tag with {{subst:PP}} on file description page. Alternatively, you may click on "Challenge speedy deletion" below the tag if you wish to provide an argument why evidence of permission is not necessary in this case.
Please see this page for more information on how to confirm permission, or if you would like to understand why we ask for permission when uploading work that is not your own, or work which has been previously published (regardless of whether it is your own). The file probably has been deleted. If you sent a permission, try to send it again after 14 days. Do not re-upload. When the VRT-member processes your mail, the file can be undeleted. Additionally you can request undeletion here, providing a link to the File-page on Commons where it was uploaded ([[:File:Lída Plachá v roli komorné.jpg]] ) and the above demanded information in your request. |
Túrelio (talk) 09:08, 10 February 2022 (UTC)
File source is not properly indicated: File:Ленин в Праге.jpg
This media was probably deleted. |
A file that you have uploaded to Wikimedia Commons, File:Ленин в Праге.jpg, was missing information about where it comes from or who created it, which is needed to verify its copyright status. The file probably has been deleted. If you've got all required information, request undeletion providing this information and the link to the concerned file (
[[:File:Ленин в Праге.jpg]] ).
If you created the content yourself, enter If someone else created the content, or if it is based on someone else's work, the source should be the address to the web page where you found it, the name and ISBN of the book you scanned it from, or similar. You should also name the author, provide verifiable information to show that the content is in the public domain or has been published under a free license by its author, and add an appropriate template identifying the public domain or licensing status, if you have not already done so. Warning: Wikimedia Commons takes copyright violations very seriously and persistent violators will be blocked from editing. Please add the required information for this and other files you have uploaded before adding more files. If you need assistance, please ask at the help desk. Thank you! |